PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr3P23090_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 660aa    MW: 72317.4 Da    PI: 6.1203
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr3P23090_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox46.46.8e-1529681857
                           HHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
               Homeobox 18 lFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                           +F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k+
  GSMUA_Achr3P23090_001 29 FFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMKN 68
                           79***********************************995 PP

2START2282.7e-711794001206
                            HHHHHHHHHHHHHHHHC-TT-EEEE.....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S. CS
                  START   1 elaeeaaqelvkkalaeepgWvkss.....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla. 77 
                            ela +a++el+++a+++ep+W   +     e +n++e++++f+++ +      ++ea+r+++vv+m+++++ve+l+d++ qW++ +  
  GSMUA_Achr3P23090_001 179 ELAVAAMEELIRMAQLNEPLWIPAAldnatEALNEEEYVRTFPRGIGprpfgLKSEASRETAVVIMNQMNVVEILMDVN-QWSNVFSg 265
                            57899******************9999*****************999********************************.******** PP

                            ...EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEE CS
                  START  78 ...kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgilie 155
                               +a+tlev+s+g      galq+m+ae+q++splvp R+++fvRy++q+ +g+w++vdvS+ds ++ p    v R++++pSg+li+
  GSMUA_Achr3P23090_001 266 ivsRAMTLEVLSTGvagnynGALQVMTAEFQVPSPLVPtRESLFVRYCKQHADGTWAVVDVSLDSLRPSP----VLRCRRRPSGCLIQ 349
                            ********************************************************************98....7************* PP

                            EECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                  START 156 pksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                            +++ng+skvtwvehv++++r++h+++++lv+sgla+ga++wv+tl+rqce+
  GSMUA_Achr3P23090_001 350 ELPNGYSKVTWVEHVEVDDRSVHSIYKPLVNSGLAFGARRWVSTLDRQCER 400
                            *************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003895.8E-81673IPR001356Homeobox domain
CDDcd000861.64E-132870No hitNo description
SuperFamilySSF466894.18E-132876IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-142976IPR009057Homeodomain-like
PfamPF000461.9E-122967IPR001356Homeobox domain
PROSITE profilePS5007113.753069IPR001356Homeobox domain
PROSITE patternPS0002704467IPR017970Homeobox, conserved site
PROSITE profilePS5084847.685170403IPR002913START domain
SuperFamilySSF559611.06E-37172402No hitNo description
CDDcd088753.74E-127174399No hitNo description
SMARTSM002342.6E-69179400IPR002913START domain
PfamPF018525.2E-60180400IPR002913START domain
Gene3DG3DSA:3.30.530.201.1E-6244397IPR023393START-like domain
SuperFamilySSF559613.88E-25419651No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009913Biological Processepidermal cell differentiation
GO:0048497Biological Processmaintenance of floral organ identity
GO:0048825Biological Processcotyledon development
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 660 aa     Download sequence    Send to blast
MNSFYKPFFI VFNAFITNHI TCCHVAFSFF KECPHPDDKQ RKELSRELGL EPLQVKFWFQ  60
NKRTQMKNQH ERQENNQLRA DNERLRAENL RYKEALSNAS CPNCGGPASL GEMSFDEHHL  120
RIENARLREE IDRISGIAAK YVGKPMASYP LLSPSMFGPG ELMRSVSGAA ETDKPMVVEL  180
AVAAMEELIR MAQLNEPLWI PAALDNATEA LNEEEYVRTF PRGIGPRPFG LKSEASRETA  240
VVIMNQMNVV EILMDVNQWS NVFSGIVSRA MTLEVLSTGV AGNYNGALQV MTAEFQVPSP  300
LVPTRESLFV RYCKQHADGT WAVVDVSLDS LRPSPVLRCR RRPSGCLIQE LPNGYSKVTW  360
VEHVEVDDRS VHSIYKPLVN SGLAFGARRW VSTLDRQCER LASVMASNIP SGDVGVITTP  420
EGRKSMLKLA ERMVMSFCGG VSASTTHQWT TLSGSGAEDV RVMTRKSVDD PGRPPGIVLN  480
AATSFWLPVP PKRVFDFLRD ESSRSEWDIL SNGGGVQEMA HIANGQDHGN CVSLLRVNST  540
NSNQSNMLIL QESCTDATGS YVIYAPVDVI AMNVVLNGGD PDYVALLPSG FAILPDGPCG  600
SGGRVEEVGS GGSLLTVAFQ ILVDSVPTAK LSLGSVATVN SLIACTVERI KASVAGEVAR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009393336.10.0PREDICTED: homeobox-leucine zipper protein ROC2-like
SwissprotQ0J9X20.0ROC2_ORYSJ; Homeobox-leucine zipper protein ROC2
TrEMBLM0SH250.0M0SH25_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P23090_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79938147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2